The Nuclear Localization Signal of Porcine Circovirus Type 4 Affects the Subcellular Localization of the Virus Capsid and the Production of Virus-like Particles

Overview

Journal Int J Mol Sci

Publisher MDPI

Specialties Biochemistry
Chemistry
Molecular Biology

Date 2024 Mar 13

PMID 38473709

Authors

Jiawei Zheng

Nan Li

Xue Li

Yaqi Han

Xinru Lv

Huimin Zhang

Linzhu Ren

Affiliations

Soon will be listed here.

Abstract

Porcine circovirus 4 (PCV4) is a newly identified virus belonging to PCV of the family, the genus. We previously found that PCV4 is pathogenic in vitro, while the virus's replication in cells is still unknown. In this study, we evaluated the N-terminal of the PCV4 capsid (Cap) and identified an NLS at amino acid residues 4-37 of the N-terminus of the PCV4 Cap, RSRYSRRRRNRRNQRRRGLWPRASRRRYRWRRKN. The NLS was further divided into two fragments (NLS-A and NLS-B) based on the predicted structure, including two α-helixes, which were located at RSRYSRRRRNRRNQRR and PRASRRRYRWRRK, respectively. Further studies showed that the NLS, especially the first α-helixes formed by the NLS-A fragment, determined the nuclear localization of the Cap protein, and the amino acid RSRY in the NLS of the PCV4 Cap was the critical motif affecting the VLP packaging. These results will provide a theoretical basis for elucidating the infection mechanism of PCV4 and developing subunit vaccines based on VLPs.

Citing Articles

Genomic composition and pathomechanisms of porcine circoviruses: A review.

Gao Y, Wang Q, Li H, Zhang S, Zhao J, Bao D Virulence. 2024; 15(1):2439524.

PMID: 39662970 PMC: 11639455. DOI: 10.1080/21505594.2024.2439524.

References

Wang D, Mai J, Lei B, Zhang Y, Yang Y, Wang N . Structure, Antigenic Properties, and Highly Efficient Assembly of PCV4 Capsid Protein. Front Vet Sci. 2021; 8:695466. PMC: 8421537. DOI: 10.3389/fvets.2021.695466. View

. The hydrophobic rich N- and C-terminal tails of β-catenin facilitate nuclear import. J Biol Chem. 2015; 290(30):18479. PMC: 4513108. DOI: 10.1074/jbc.A114.603209. View

Li H, Chen X, Zhao Y, Zhang H, Zheng L, Wang L . Simultaneous detection and phylogenetic analysis of porcine epidemic diarrhea virus and porcine circovirus 4 in Henan province, China. Arch Virol. 2023; 168(6):161. DOI: 10.1007/s00705-023-05791-w. View

Li X, Chen S, Niu G, Zhang X, Ji W, Ren Y . Porcine Circovirus Type 4 Strains Circulating in China Are Relatively Stable and Have Higher Homology with Mink Circovirus than Other Porcine Circovirus Types. Int J Mol Sci. 2022; 23(6). PMC: 8950282. DOI: 10.3390/ijms23063288. View

Zhang T, Zhou Y, Li L, Zhao Y, De Felici M, Reiter R . Melatonin protects prepuberal testis from deleterious effects of bisphenol A or diethylhexyl phthalate by preserving H3K9 methylation. J Pineal Res. 2018; 65(2):e12497. DOI: 10.1111/jpi.12497. View

Li H, Huo Y, He X, Yao L, Zhang H, Cui Y . A male germ-cell-specific ribosome controls male fertility. Nature. 2022; 612(7941):725-731. DOI: 10.1038/s41586-022-05508-0. View

Sanchez A, Guerrero-Juarez C, Ramirez J, Newcomb L . Nuclear localized Influenza nucleoprotein N-terminal deletion mutant is deficient in functional vRNP formation. Virol J. 2014; 11:155. PMC: 4177073. DOI: 10.1186/1743-422X-11-155. View

Shuai J, Fu L, Zhang X, Zhu B, Li X, He Y . Functional exchangeability of the nuclear localization signal (NLS) of capsid protein between PCV1 and PCV2 in vitro: Implications for the role of NLS in viral replication. Virol J. 2011; 8:341. PMC: 3145596. DOI: 10.1186/1743-422X-8-341. View

Yuan X, Yuan Q, Feng S, Deng Z . Evaluation of the protective efficacy of virus-like particles based on PCV 2b and 2d subtypes against mixed challenge in mice. Pol J Vet Sci. 2022; 25(2):195-205. DOI: 10.24425/pjvs.2022.141803. View

10.

Gileadi O . Recombinant Protein Expression in E. coli : A Historical Perspective. Methods Mol Biol. 2017; 1586:3-10. DOI: 10.1007/978-1-4939-6887-9_1. View

11.

Niu G, Zhang X, Ji W, Chen S, Li X, Yang L . Porcine circovirus 4 rescued from an infectious clone is replicable and pathogenic in vivo. Transbound Emerg Dis. 2022; 69(5):e1632-e1641. DOI: 10.1111/tbed.14498. View

12.

Chen X, Zhao Y, Liu X, Han Y, Zhang Y, Hou C . Molecular detection and genetic characteristics of a novel porcine circovirus (porcine circovirus 4) and porcine reproductive and respiratory syndrome virus in Shaanxi and Henan Provinces of China. Comp Immunol Microbiol Infect Dis. 2023; 98:102009. DOI: 10.1016/j.cimid.2023.102009. View

13.

Allan G, McNeilly F, Kennedy S, Daft B, CLARKE E, Ellis J . Isolation of porcine circovirus-like viruses from pigs with a wasting disease in the USA and Europe. J Vet Diagn Invest. 1998; 10(1):3-10. DOI: 10.1177/104063879801000102. View

14.

Zhang H, Hu W, Li J, Liu T, Zhou J, Opriessnig T . Novel circovirus species identified in farmed pigs designated as Porcine circovirus 4, Hunan province, China. Transbound Emerg Dis. 2019; 67(3):1057-1061. DOI: 10.1111/tbed.13446. View

15.

Ji W, Zhang X, Niu G, Chen S, Li X, Yang L . Expression and immunogenicity analysis of the capsid proteins of porcine circovirus types 2 to 4. Int J Biol Macromol. 2022; 218:828-838. DOI: 10.1016/j.ijbiomac.2022.07.204. View

16.

Mou C, Wang M, Pan S, Chen Z . Identification of Nuclear Localization Signals in the ORF2 Protein of Porcine Circovirus Type 3. Viruses. 2019; 11(12). PMC: 6950156. DOI: 10.3390/v11121086. View

17.

Duan Z, Deng S, Ji X, Zhao J, Yuan C, Gao H . Nuclear localization of Newcastle disease virus matrix protein promotes virus replication by affecting viral RNA synthesis and transcription and inhibiting host cell transcription. Vet Res. 2019; 50(1):22. PMC: 6425612. DOI: 10.1186/s13567-019-0640-4. View

18.

Mori Y, Okabayashi T, Yamashita T, Zhao Z, Wakita T, Yasui K . Nuclear localization of Japanese encephalitis virus core protein enhances viral replication. J Virol. 2005; 79(6):3448-58. PMC: 1075736. DOI: 10.1128/JVI.79.6.3448-3458.2005. View

19.

Tischer I, Gelderblom H, Vettermann W, Koch M . A very small porcine virus with circular single-stranded DNA. Nature. 1982; 295(5844):64-6. DOI: 10.1038/295064a0. View

20.

Jans D, Xiao C, Lam M . Nuclear targeting signal recognition: a key control point in nuclear transport?. Bioessays. 2000; 22(6):532-44. DOI: 10.1002/(SICI)1521-1878(200006)22:6<532::AID-BIES6>3.0.CO;2-O. View