A Novel Defensin-like Peptide from Salivary Glands of the Hard Tick, Haemaphysalis Longicornis

Overview

Journal Protein Sci

Specialty Biochemistry

Date 2009 Dec 23

PMID 20027626

Citations 13

Authors

Xiangyun Lu

Qiaolin Che

Yi Lv

Meijuan Wang

ZeKuan Lu

Feifei Feng

Jingze Liu

Haining Yu

Affiliations

Soon will be listed here.

Abstract

A novel defensin-like antimicrobial peptide named longicornsin was isolated from the salivary glands of the hard tick, Haemaphysalis longicornis, using a 10-kDa cut-off Centriprep filter and reversed-phase high-performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined as DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVG by Edman degradation. The cDNA encoding longicornsin was cloned by cDNA library screening. The predicted protein from the cDNA sequence was composed of 78 amino acids including a mature longicornsin. It showed similarity with defensin-like peptides from other ticks by BLAST search. Different from most other tick defensin-like peptides, longicornsin had a C-terminal extension. Purified longicornsin exerted potent antimicrobial activities against bacteria and fungi. Interestingly, it even showed strong antimicrobial ability against drug-resistant microorganisms and Helicobacter pylori. The results of this study indicated that longicornsin is a potential candidate for novel antimicrobial drug design.

Citing Articles

Rheological and Biological Properties of Adhesive Skin Secretions from (Anura: Alsodidae).

Contreras F, Sepulveda D, Amaral A, Nunez J, Trovatti E, Suarez-Villota E Scientifica (Cairo). 2024; 2024:2722351.

PMID: 38566624 PMC: 10985274. DOI: 10.1155/2024/2722351.

Peptidomics Analysis Reveals the Buccal Gland of Jawless Vertebrate Lamprey as a Source of Multiple Bioactive Peptides.

Wang Y, Sun F, Wang Z, Duan X, Li Q, Pang Y Mar Drugs. 2023; 21(7).

PMID: 37504920 PMC: 10381800. DOI: 10.3390/md21070389.

Defensins as a promising class of tick antimicrobial peptides: a scoping review.

Wu J, Zhou X, Chen Q, Chen Z, Zhang J, Yang L Infect Dis Poverty. 2022; 11(1):71.

PMID: 35725522 PMC: 9208123. DOI: 10.1186/s40249-022-00996-8.

A physiologic overview of the organ-specific transcriptome of the cattle tick Rhipicephalus microplus.

Tirloni L, Braz G, Nunes R, Gandara A, Vieira L, Assumpcao T Sci Rep. 2020; 10(1):18296.

PMID: 33106528 PMC: 7588415. DOI: 10.1038/s41598-020-75341-w.

Comparative proteomics of the vector Dermacentor reticulatus revealed differentially regulated proteins associated with pathogen transmission in response to laboratory infection with Rickettsia slovaca.

Flores-Ramirez G, Sallay B, Danchenko M, Lakhneko O, Spitalska E, Skultety L Parasit Vectors. 2019; 12(1):318.

PMID: 31234913 PMC: 6591964. DOI: 10.1186/s13071-019-3564-y.

References

Motoyashiki T, Tu A, Azimov D, Ibragim K . Isolation of anticoagulant from the venom of tick, Boophilus calcaratus, from Uzbekistan. Thromb Res. 2003; 110(4):235-41. DOI: 10.1016/s0049-3848(03)00409-2. View

Johns R, Ohnishi J, Broadwater A, Sonenshine D, de Silva A, Hynes W . Contrasts in tick innate immune responses to Borrelia burgdorferi challenge: immunotolerance in Ixodes scapularis versus immunocompetence in Dermacentor variabilis (Acari: Ixodidae). J Med Entomol. 2001; 38(1):99-107. DOI: 10.1603/0022-2585-38.1.99. View

Hynes W, Ceraul S, Todd S, Seguin K, Sonenshine D . A defensin-like gene expressed in the black-legged tick, Ixodes scapularis. Med Vet Entomol. 2005; 19(4):339-44. DOI: 10.1111/j.1365-2915.2005.00579.x. View

Liu J, Liu Z, Zhang Y, Yang X, Gao Z . Biology of Dermacentor silvarum (Acari: Ixodidae) under laboratory conditions. Exp Appl Acarol. 2005; 36(1-2):131-8. DOI: 10.1007/s10493-005-1271-1. View

Rego R, Kovar V, Kopacek P, Weise C, Man P, Sauman I . The tick plasma lectin, Dorin M, is a fibrinogen-related molecule. Insect Biochem Mol Biol. 2006; 36(4):291-9. DOI: 10.1016/j.ibmb.2006.01.008. View

Liu Z, Liu H, Liu X, Wu X . Purification and cloning of a novel antimicrobial peptide from salivary glands of the hard tick, Ixodes sinensis. Comp Biochem Physiol B Biochem Mol Biol. 2008; 149(4):557-61. DOI: 10.1016/j.cbpb.2007.10.002. View

Johns R, Sonenshine D, Hynes W . Response of the tick Dermacentor variabilis (Acari: Ixodidae) to hemocoelic inoculation of Borrelia burgdorferi (Spirochetales). J Med Entomol. 2000; 37(2):265-70. DOI: 10.1603/0022-2585-37.2.265. View

Dai G, Cheng N, Dong L, Muramatsu M, Xiao S, Wang M . Bactericidal and morphological effects of NE-2001, a novel synthetic agent directed against Helicobacter pylori. Antimicrob Agents Chemother. 2005; 49(8):3468-73. PMC: 1196265. DOI: 10.1128/AAC.49.8.3468-3473.2005. View

Zasloff M . Magainins, a class of antimicrobial peptides from Xenopus skin: isolation, characterization of two active forms, and partial cDNA sequence of a precursor. Proc Natl Acad Sci U S A. 1987; 84(15):5449-53. PMC: 298875. DOI: 10.1073/pnas.84.15.5449. View

10.

Ceraul S, Dreher-Lesnick S, Gillespie J, Rahman M, Azad A . New tick defensin isoform and antimicrobial gene expression in response to Rickettsia montanensis challenge. Infect Immun. 2007; 75(4):1973-83. PMC: 1865714. DOI: 10.1128/IAI.01815-06. View

11.

Tsuji N, Battsetseg B, Boldbaatar D, Miyoshi T, Xuan X, Oliver Jr J . Babesial vector tick defensin against Babesia sp. parasites. Infect Immun. 2007; 75(7):3633-40. PMC: 1932947. DOI: 10.1128/IAI.00256-07. View

12.

Johns R, Sonenshine D, Hynes W . Control of bacterial infections in the hard tick Dermacentor variabilis (Acari: Ixodidae): evidence for the existence of antimicrobial proteins in tick hemolymph. J Med Entomol. 1998; 35(4):458-64. DOI: 10.1093/jmedent/35.4.458. View

13.

Lomas L, Turner P, Rees H . A novel neuropeptide-endocrine interaction controlling ecdysteroid production in ixodid ticks. Proc Biol Sci. 1997; 264(1381):589-96. PMC: 1688385. DOI: 10.1098/rspb.1997.0084. View

14.

Yu D, Sheng Z, Xu X, Li J, Yang H, Liu Z . A novel antimicrobial peptide from salivary glands of the hard tick, Ixodes sinensis. Peptides. 2005; 27(1):31-5. DOI: 10.1016/j.peptides.2005.06.020. View

15.

Zasloff M . Antibiotic peptides as mediators of innate immunity. Curr Opin Immunol. 1992; 4(1):3-7. DOI: 10.1016/0952-7915(92)90115-u. View

16.

Bior A, Essenberg R, Sauer J . Comparison of differentially expressed genes in the salivary glands of male ticks, Amblyomma americanum and Dermacentor andersoni. Insect Biochem Mol Biol. 2002; 32(6):645-55. DOI: 10.1016/s0965-1748(01)00143-6. View

17.

Bignami G . A rapid and sensitive hemolysis neutralization assay for palytoxin. Toxicon. 1993; 31(6):817-20. DOI: 10.1016/0041-0101(93)90389-z. View

18.

Fogaca A, Lorenzini D, Kaku L, Esteves E, Bulet P, Daffre S . Cysteine-rich antimicrobial peptides of the cattle tick Boophilus microplus: isolation, structural characterization and tissue expression profile. Dev Comp Immunol. 2003; 28(3):191-200. DOI: 10.1016/j.dci.2003.08.001. View

19.

Chen L, Li Y, Li J, Xu X, Lai R, Zou Q . An antimicrobial peptide with antimicrobial activity against Helicobacter pylori. Peptides. 2007; 28(8):1527-31. DOI: 10.1016/j.peptides.2007.07.007. View

20.

Xu X, Li J, Lu Q, Yang H, Zhang Y, Lai R . Two families of antimicrobial peptides from wasp (Vespa magnifica) venom. Toxicon. 2005; 47(2):249-53. DOI: 10.1016/j.toxicon.2005.10.015. View