» Authors » Elin Jorgensen

Elin Jorgensen

Explore the profile of Elin Jorgensen including associated specialties, affiliations and a list of published articles. Areas
Snapshot
Articles 11
Citations 78
Followers 0
Related Specialties
Top 10 Co-Authors
Published In
Affiliations
Soon will be listed here.
Recent Articles
1.
Fazli M, Kirketerp-Moller K, Sonne D, Balchen T, Gundersen G, Jorgensen E, et al.
Adv Wound Care (New Rochelle) . 2024 May; 13(11):529-541. PMID: 38780759
Biofilm infections in chronic wounds are common and pose a significant clinical challenge. This challenge was addressed by developing the SoftOx Biofilm Eradicator (SBE) composed of hypochlorous acid (HOCl) and...
2.
Adler D, Jorgensen E, Cornett C
Front Vet Sci . 2022 Nov; 9:1007399. PMID: 36439347
Objective: To determine the synovial fluid (SF) concentrations of lidocaine and mepivacaine after intra-articular injection with clinically relevant doses to the distal interphalangeal (DIP), metacarpophalangeal (MCP), middle carpal (MC), and...
3.
Jorgensen E, Bjarnsholt T, Jacobsen S
Animals (Basel) . 2021 Oct; 11(10). PMID: 34679846
In chronic wounds in humans, biofilm formation and wound chronicity are linked, as biofilms contribute to chronic inflammation and delayed healing. Biofilms are aggregates of bacteria, and living as biofilms...
4.
Pedersen R, Kromker V, Bjarnsholt T, Dahl-Pedersen K, Buhl R, Jorgensen E
Front Vet Sci . 2021 May; 8:656810. PMID: 34026893
Bovine mastitis is one of the most important diseases in the dairy industry and has detrimental impact on the economy and welfare of the animals. Further, treatment failure results in...
5.
Haffner S, Parra-Ortiz E, Browning K, Jorgensen E, Skoda M, Montis C, et al.
ACS Nano . 2021 Mar; 15(4):6787-6800. PMID: 33724786
In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]). In doing so, smooth mesoporous nanoparticles were compared to virus-like...
6.
Adler D, Ostergaard S, Jorgensen E, Jacobsen S
BMC Vet Res . 2020 Jul; 16(1):250. PMID: 32680516
Background: Castration of the stallion is one of the most frequently performed surgical procedures in the horse. Recently barbed suture materials for surgical wound closure were introduced to the market...
7.
Adler D, Serteyn D, Franck T, Jorgensen E, Christophersen M, Denwood M, et al.
Am J Vet Res . 2020 May; 81(6):479-487. PMID: 32436793
Objective: To compare the extent of inflammation and catabolic collagen response in the middle carpal joints (MCJs) of healthy horses following intra-articular injection of 2% lidocaine, 2% mepivacaine, lactated Ringer...
8.
Jorgensen E, Bay L, Skovgaard L, Bjarnsholt T, Jacobsen S
Adv Wound Care (New Rochelle) . 2019 Aug; 8(10):487-498. PMID: 31456906
Relevant animal models to study effects of bacterial aggregates on wound healing are lacking. We aimed at establishing an equine wound model with bacterial aggregates to investigate the impact of...
9.
Jorgensen E, Pirone A, Jacobsen S, Miragliotta V
Vet Dermatol . 2019 Jul; 30(5):417-e126. PMID: 31328349
Background: The re-epithelialization process in equine wound healing is incompletely described. For epithelial cells to migrate during embryogenesis they undergo epithelial-to-mesenchymal transition (EMT); this phenotypic transition occurs during wound healing...
10.
Jorgensen E, Lazzarini G, Pirone A, Jacobsen S, Miragliotta V
Ann Anat . 2018 May; 218:205-212. PMID: 29730469
Introduction: Information on microscopic anatomy of equine skin is sparse. In horses, limb wounds often become chronic and/or non-healing whereas body wounds heal normally. These dissimilarities in healing patterns might...