Primary Structure of a Base Non-specific Ribonuclease from Rhizopus Niveus

Overview

Journal J Biochem

Publisher Oxford University Press

Specialty Biochemistry

Date 1988 Mar 1

PMID 3391995

Citations 31

Authors

H Horiuchi

K Yanai

M Takagi

K Yano

E Wakabayashi

A SANDA

S Mine

K Ohgi

M Irie

Affiliations

Soon will be listed here.

Abstract

The primary structure of a base non-specific ribonuclease from Rhizopus niveus (RNase Rh) was determined by nucleotide sequence analysis of the DNA fragment encoding RNase Rh gene including signal peptide sequence, and amino acid sequence analysis of the peptide obtained from RNase Rh and RNase Rh' (a protease-modified RNase Rh created during the course of purification). The sequence determined was: MKAVLALATLIGSTLASSCSSTA LSCSNSANSDTCCSPEYGLVVLNMQWAPGYGPANAFTLHGLWPDKCSGAYAPSGGCDSN RASSSIASVIKSKDSSLYNSMLTYWPSNQGNNNVFWSHEWSKHGTCVSTYDPDCYDNYE EGEDIVDYFQKAMDLRSQYNVYKAFSSNGITPGGTYTATEMQSAIESYFGAKAKIDCSSG TLSDVALYFYVRGRDTYVITDALSTGSCSGDVEYPTK (the sequence of signal peptide is underlined). The sequence indicates that the homology with the sequence of RNase T2 from A. oryzae with the same base specificity is about 42% and that the sequences around the two histidine residues which are supposed to be involved in the active site are fairly conserved.

Citing Articles

Genome-wide identification and characterization of legume gene family and analysis of , a soybean gene, function in nodulation.

Azizkhani N, Mirzaei S, Torkzadeh-Mahani M 3 Biotech. 2021; 11(12):495.

PMID: 34881158 PMC: 8593123. DOI: 10.1007/s13205-021-03025-x.

Charged Residues in the Membrane Anchor of the Pestiviral E Protein Are Important for Processing and Secretion of E and Recovery of Infectious Viruses.

Oetter K, Kuhn J, Meyers G Viruses. 2021; 13(3).

PMID: 33801849 PMC: 8002126. DOI: 10.3390/v13030444.

Downstream Sequences Control the Processing of the Pestivirus E-E1 Precursor.

Mu Y, Bintintan I, Meyers G J Virol. 2020; 95(1).

PMID: 33028718 PMC: 7737733. DOI: 10.1128/JVI.01905-20.

Finding a Compatible Partner: Self-Incompatibility in European Pear (); Molecular Control, Genetic Determination, and Impact on Fertilization and Fruit Set.

Claessen H, Keulemans W, Van de Poel B, De Storme N Front Plant Sci. 2019; 10:407.

PMID: 31057563 PMC: 6477101. DOI: 10.3389/fpls.2019.00407.

Reproduction in woody perennial Citrus: an update on nucellar embryony and self-incompatibility.

Zhang S, Liang M, Wang N, Xu Q, Deng X, Chai L Plant Reprod. 2018; 31(1):43-57.

PMID: 29457194 DOI: 10.1007/s00497-018-0327-4.